PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do008164.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB
Protein Properties Length: 851aa    MW: 93230.2 Da    PI: 4.7828
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do008164.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.62.4e-128451048
                     HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
       Do008164.1  8 AILSRAVQTYQGKNWKKIAECFP-DRTDVQCLHRWQKVL 45
                     57899******************.************986 PP

2Myb_DNA-binding62.39.9e-205197148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEde++v+ v+++G++ W+tIa+ ++ gR +kqc++rw+++l
       Do008164.1 51 KGPWSKEEDEIIVQMVNKYGPKKWSTIAQALP-GRIGKQCRERWHNHL 97
                     79******************************.*************97 PP

3Myb_DNA-binding47.54.3e-15103145145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE+  l++a++++G++ W+   + ++ gRt++ +k++w+
       Do008164.1 103 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNAIKNHWN 145
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.491145IPR017930Myb domain
CDDcd001677.01E-10745No hitNo description
Gene3DG3DSA:1.10.10.601.4E-19757IPR009057Homeodomain-like
SMARTSM007173.4E-5747IPR001005SANT/Myb domain
SuperFamilySSF466896.1E-11755IPR009057Homeodomain-like
PfamPF002491.4E-9845IPR001005SANT/Myb domain
PROSITE profilePS5129431.9246101IPR017930Myb domain
SuperFamilySSF466891.91E-3148144IPR009057Homeodomain-like
SMARTSM007171.5E-185099IPR001005SANT/Myb domain
CDDcd001672.35E-165397No hitNo description
PfamPF139212.4E-1854114No hitNo description
Gene3DG3DSA:1.10.10.604.2E-2758100IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.2E-21101152IPR009057Homeodomain-like
SMARTSM007174.4E-14102150IPR001005SANT/Myb domain
PROSITE profilePS5129419.654102152IPR017930Myb domain
CDDcd001675.75E-11105145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 851 aa     Download sequence    Send to blast
MRPLPPDAIL SRAVQTYQGK NWKKIAECFP DRTDVQCLHR WQKVLNPELV KGPWSKEEDE  60
IIVQMVNKYG PKKWSTIAQA LPGRIGKQCR ERWHNHLNPA INKEAWTQEE EITLIHAHRM  120
YGNKWAELTK FLPGRTDNAI KNHWNSSVKK KVDSYISSGL LSQVPCLPLI ECPAQCNSLS  180
AMNLQNNGDS GCNAQNTNVA LSCDLQVNMD ANTREAQDSQ SSMCQGACYT STEAVGSALP  240
DGHHHLSSSF SQRMDLQMDV NEGSGNSMFV DDQTLCSTSN QEKSMVPFGV AQEMPVSVLS  300
SVSDAEQKLH LVSDADSLKS ELWKDVSLQT LISGDAVDAD SSSGLNQLPE SSTTDTNFLA  360
QPYPLHTSNP SSVMETVYEQ SASVAISPSF ICLDSLSNAS QNRSEPIEMP NSEAEMITCS  420
NNSFCDAEQS AKPGSSDDRP LGFTMTESIT NCSGQSSADA EETVANTAKE QLLKDIETVP  480
DDKNSEGALF YEPPRFPGLD VPFISCDLVT SADLQEFSPL GIRQWMRSTM NVPTPLRLWG  540
SPTHDESPDV LKSAAESFLC TPSIMKKRQR GLLSPTPDKR IEKKSGKAKE MTDISYMIAA  600
TCSMNATKDE AIVTESVVCA EQSSFKHLDK KLEFSDGNEN VDGAPEQARD AQNAGNKQLV  660
DVQGGQQCSS PNVANPNTDL PDNLQPAAIL LEHNRNDLIA TDHGAKPESL SFCKEVVCSK  720
SKPAELVVEK SSPCINADYE YVNLLADTPG VKRGLESPSA WKSPWYIDMH MHFQGFVSPA  780
DRTYDALGLV KQISKQSAAA AVEACEVLAS GSRTSGSDKE NKENTDDKEP VTRKSQAKIM  840
VRNHQLLTLV N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-65715214159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-65715214159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967414.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLK3XEN20.0K3XEN2_SETIT; Uncharacterized protein
STRINGSi000349m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.22e-92myb domain protein 3r-4